PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g08600.1.p
Common NameBRADI_2g08600, LOC104582530
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Nin-like
Protein Properties Length: 283aa    MW: 30091 Da    PI: 8.9772
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g08600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK73.52.6e-234188451
            RWP-RK  4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiks 51
                      ++s e++sk Fslpi++AA+ Lgvc++vLKriCR +GI RWP+Rki s
  Bradi2g08600.1.p 41 SLSYEEISKLFSLPIAEAASILGVCTSVLKRICRTHGIVRWPYRKIVS 88
                      6899*****************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.51725109IPR003035RWP-RK domain
PfamPF020422.3E-214287IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MQKRPMAADA QAQQLPLEQA AAAVQAPVAP APAQPKPTRV SLSYEEISKL FSLPIAEAAS  60
ILGVCTSVLK RICRTHGIVR WPYRKIVSGK TGDDVKNAER EKAKELLELS KIAKQKASPG  120
GLQGVPKSQQ GSTKAGPSLA HVSQAKDIPT YMDDFKNGFP SSGLSCETMK WWGASSHTET  180
ASAKGDSREA PESTNEASKG MTDDELDWGA DEAEADTDGV VTSEPSAQLC SLRRKAAGDG  240
RRLLNGDTGR GQGFCRLNKR QKIALAQVFG ASLPEQWSSK LA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010230688.10.0PREDICTED: uncharacterized protein LOC104582530
TrEMBLA0A0Q3ICD50.0A0A0Q3ICD5_BRADI; Uncharacterized protein
STRINGBRADI2G08600.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP67053242
Representative plantOGRP866899
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74480.13e-10RWP-RK domain-containing protein